PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g005510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 322aa    MW: 35369.7 Da    PI: 8.5987
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g005510.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18167221256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  LAk+l+L +rqV vWFqNrRa+ k
  Csa16g005510.1 167 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 221
                     788899***********************************************98 PP

2HD-ZIP_I/II122.81.7e-39167256191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+ +LEe+F+e+++L+p++K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Csa16g005510.1 167 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVSELR-AL 256
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-351123IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.99E-19148224IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-19150221IPR009057Homeodomain-like
PROSITE profilePS5007117.313163223IPR001356Homeobox domain
SMARTSM003892.6E-15165227IPR001356Homeobox domain
PfamPF000464.2E-16167221IPR001356Homeobox domain
CDDcd000861.22E-15167224No hitNo description
PROSITE patternPS000270198221IPR017970Homeobox, conserved site
SMARTSM003401.6E-26223266IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11223257IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGERDDGLGL SLSLSLGFNQ KEPSSRSNPM PLASSYSSSP HMHMHMQQQQ SNNYSHPQKN  60
QNSWINMFQS SERNSDMRSF LRGIDVNRAP STVVVDVEDD AAGVSSPNST VSSVMSGKRS  120
ERELMAAAAA AGGGSRVEDN EMERASCSLG GGSDNEDGSG NGDDGSRKKL RLSKEQALVL  180
EETFKEHSTL NPKQKMALAK QLNLRTRQVE VWFQNRRART KLKQTEVDCE YLKRCCENLT  240
EENRRLQKEV SELRALKLSP HLYMHMKPPT TLTMCPSCER VAVTSSPSSV APPVMTSSSP  300
MGPMSPWAAI PLRQRPAAGS H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165171SRKKLRL
2215223RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4407810.0AJ440781.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT3 (hat3 gene).
GenBankAY0995650.0AY099565.1 Arabidopsis thaliana homeobox-leucine zipper protein HAT3 (At3g60390) mRNA, complete cds.
GenBankBT0087130.0BT008713.1 Arabidopsis thaliana At3g60390 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010469193.10.0PREDICTED: homeobox-leucine zipper protein HAT3
SwissprotP466020.0HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLD7LRP70.0D7LRP7_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.5__2504__AT3G60390.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-126homeobox-leucine zipper protein 3